PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peaxi162Scf00765g00015.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia
Family MYB_related
Protein Properties Length: 654aa    MW: 73032.5 Da    PI: 6.009
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peaxi162Scf00765g00015.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding44.82.9e-143882347
                              SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
           Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                              rWT++E+ l++ + k +G+g+W++I+++    Rt+ q+ s+ qk+
  Peaxi162Scf00765g00015.1 38 RWTEDEHRLFLSGLKIHGKGNWAKISKHCLPSRTPQQIASHAQKH 82
                              9*************************99777************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129419.4093187IPR017930Myb domain
SuperFamilySSF466892.08E-143587IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.3E-123582IPR009057Homeodomain-like
SMARTSM007175.4E-123585IPR001005SANT/Myb domain
TIGRFAMsTIGR015576.3E-113685IPR006447Myb domain, plants
CDDcd001674.48E-123883No hitNo description
PfamPF002491.1E-113882IPR001005SANT/Myb domain
SMARTSM002682.3E-153185549IPR004000Actin family
SuperFamilySSF530671.0E-51192328No hitNo description
Gene3DG3DSA:3.30.420.403.2E-61195360No hitNo description
PfamPF000225.1E-106195533IPR004000Actin family
PRINTSPR001902.6E-37202211IPR004000Actin family
PRINTSPR001902.6E-37225236IPR004000Actin family
CDDcd000129.99E-15254375No hitNo description
PRINTSPR001902.6E-37259277IPR004000Actin family
PRINTSPR001902.6E-37290303IPR004000Actin family
PRINTSPR001902.6E-37315334IPR004000Actin family
SuperFamilySSF530672.01E-69323533No hitNo description
Gene3DG3DSA:3.90.640.101.4E-21361439No hitNo description
PRINTSPR001902.6E-37413429IPR004000Actin family
Gene3DG3DSA:3.30.420.401.3E-21440533No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 654 aa     Download sequence    Send to blast
MGRNNMCREK GKKIKLFGVT ISTTDSANSG RKITKGTRWT EDEHRLFLSG LKIHGKGNWA  60
KISKHCLPSR TPQQIASHAQ KHFIKIAETN ERRRRNKPSV FDVNLEETSS EAILQENNNV  120
GYEHAIVVFK NQEHDDSSVT LENQEHDGII VPLEIQEHGQ DHQETASVEV VTPIAAIPAA  180
TSQYQSFVIP SYSMVGFAGD DSPRTVFPSI AGRPRHTGVM VGMGQKDVYV GDEALRRGIL  240
TLKYPIEHGY VSEWDAMEQI WNHTYYNELR VAPEEHPVLL TEAALNDKVN REKMTQIMFE  300
TLNVPAMYVA TQAVLALYSN GCSTGIVLDS GDGLSQIVPI YEGYALPHAI SRLSLGGSDL  360
TGYLGKILTE IGGYPCSRTM YREHVCSMKE TTSYVALDFE QEIEKAKNCS KSVEMSYELP  420
DGTPFNVGVV RFCCPEVLFQ PSLVGMETTG IHEKTYNSIM RCDVDIRKDL FSNIVLSGGS  480
TMFPGVADRM SKEITALAPS SMNINVVASP WRKYSVWMGG SILASLSSFQ QIHPIKKGNQ  540
WTEDEYRLFL RGLKIRRRRN KPSVFYINLE NTNPKEISEE NSSNVSSEHA IVLFKNQEHD  600
DSTVTLENQE HNGIIAPLEI QEHDANIVVE EHGQDHQETA SVEVVTPIAA IPAC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1nlv_A1e-17719653220355Actin
1nm1_A1e-17719653220355Actin
1nmd_A1e-17719653220355Actin
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011074742.10.0PREDICTED: actin-104
SwissprotP812280.0ACT5_SOLTU; Actin-66 (Fragment)
TrEMBLI2AWM30.0I2AWM3_SESIN; Beta-actin
STRINGGRMZM2G047055_P020.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA74541230
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61620.12e-19MYB_related family protein